PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00419-augustus-gene-0.36-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 223aa    MW: 24177.5 Da    PI: 6.4811
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00419-augustus-gene-0.36-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.58.4e-42701691100
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvye 64 
                                                    +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da+ss+vye
  maker-scaffold00419-augustus-gene-0.36-mRNA-1  70 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKLLQDLPETQRADAVSSMVYE 133
                                                    7*************************************************************** PP

                                         DUF260  65 AearardPvyGavgvilklqqqleqlkaelallkee 100
                                                    A+ar+rdPvyG++g i +lq+ql++l+a+la++++e
  maker-scaffold00419-augustus-gene-0.36-mRNA-1 134 ANARIRDPVYGSAGAICHLQKQLSELQAQLARAQAE 169
                                                    *******************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.73769170IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4170167IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEYKGQTAIA SPPANTVPST AYSYSPSNTS SLSPHAAQCS PSFPSPPSKS SPPPSLPPSP  60
PTPPQIVLSP CAACKILRRR CVEKCVLAPY FPPTDPLKFT IAHRVFGASN IIKLLQDLPE  120
TQRADAVSSM VYEANARIRD PVYGSAGAIC HLQKQLSELQ AQLARAQAEL VNMQCQQHNL  180
LALLCMEVSQ TQECSLQQEP SYTDTSCFLD DNSLGSTWET LWA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027000.15e-93PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW9RZL79e-92W9RZL7_9R
STRINGPOPTR_0008s04350.13e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-61LOB domain-containing protein 1